PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0001s0480.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family MYB
Protein Properties Length: 2107aa    MW: 230158 Da    PI: 5.9926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0001s0480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding284.9e-099641006347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                            WT  E +l++da++ +G++ +k+I++ +   +t+ qc+ ++ k 
  Mapoly0001s0480.1.p  964 QWTDFERDLFLDAIANHGKD-FKSISEQVV-SKTPSQCRTFYSKI 1006
                           7*****************99.*********.**********9876 PP

2Myb_DNA-binding33.78.3e-1112901331346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                           +WT+eE e++++ ++++G++ W++  + ++ g++  q+k ++q+
  Mapoly0001s0480.1.p 1290 SWTQEEKEKFAEIIRRHGKD-WTLLDESLP-GKSMTQIKTYFQN 1331
                           7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-14749812IPR009057Homeodomain-like
PROSITE profilePS5129317.76761812IPR017884SANT domain
SMARTSM007176.2E-7762810IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-4764809IPR009057Homeodomain-like
PROSITE profilePS5129315.0089601011IPR017884SANT domain
SuperFamilySSF466891.5E-99611012IPR009057Homeodomain-like
SMARTSM007171.3E-79611009IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-69621008IPR009057Homeodomain-like
PfamPF002492.0E-79641005IPR001005SANT/Myb domain
CDDcd001671.28E-59651003No hitNo description
SuperFamilySSF466891.15E-1112811335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-812831332IPR009057Homeodomain-like
PROSITE profilePS512939.52112861337IPR017884SANT domain
SMARTSM007177.8E-912871335IPR001005SANT/Myb domain
CDDcd001676.94E-712901333No hitNo description
PfamPF002491.5E-912901331IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2107 aa     Download sequence    Send to blast
MEQRVDRYAS GRGEEAHRRG VTGSQQLDTG QRDSSSLDKE MEARMDRYAS GRDTYARDAA  60
HSGKETSSTY DWKRRDRSSA TQWSPPFTSS SSSVQEGSGR FHGGFDLPTS TSSPQPSPFS  120
GASSLLGTDI AHDETSHMSP PKRPRPSRGE GTDSGHDEAS HPSVPTTKRP RLGWGQGLAK  180
YEKKKGTDGE DCSKGAHAAT KDENVKKTNA LSEEETSAER ASKPGNCPVS SSSTARTLLP  240
EIGSDKFVSP VEGEVHRPDG SSINLELSND ARHGNAVHGF HTSTSEVFCV SSDTIGPSGD  300
PLTSQAPGHD FLLSKDPINT ICAQKKDSSE DKSLQEGSPQ TLQSKLVSGL PSDMSGWSKE  360
AIAQQLLILE AEVEVVEKEL AKLAREDDGD TVDEATLDSS VFAACELVDM DEHNKANQSE  420
SPQESGAPDT KASDLEVEVT TVVTSVEVAP AALVADKANS QVIEVQVLPS VEELSISTVV  480
EDAHTEANDP SKSDSECQTL QDSDEQMPLT GNSEQCESLS CACHGPDCGL CDVSDDDDEE  540
LPATNLGIGG LSDLMFYRYV FSIWNLILEN RRLARKALEP FQHLLLKDEN SLDFKVNGSL  600
ENTTVWIQNE ERHIKNQEQM MVKLSERKKM LTFKERVLAV KYRALKDECY QGQLGLCHRR  660
DRVKPVRRWE VERRTAANFA VASQRSTLRL RPIIAGPTRL YTGQEDAHTR RRFLAMNPAN  720
RLRQDLKMPE MILDEKERCS RRFLSRNGLV EDPVSFEQER KSVNPWTDEE KTLFLEKFPL  780
FNKNFSKIAS YFQHKTTADC IEFYYRNQKS EDFEKIKRRR QQLKKRRDYS LSASQGVKSS  840
RGSSHKVVEK ARPVSTYDSG NLDQLVVKSG FVKENKSVSS EVKEMKAVSA SDAATSGISP  900
CSHCIGTPST SKNYHDKLSV KGGSAFVTPF GKVSSVEEHG DRKGNRTSPV LRDVVVENED  960
NESQWTDFER DLFLDAIANH GKDFKSISEQ VVSKTPSQCR TFYSKIRKRY RLDDMAEQAP  1020
ETSPMDVGGL SSKSPAEIKV KLDVAGESAL DNSKSTDLGI VDMQKDSNAA EGMCKVEVVE  1080
GNEMADGLSL LGEAVVNNLT NIPSENTGDE TKECCDAKEA RGEDSASKGE ELVEAVTVCP  1140
TVDDQKQREQ SVKVEPETEV PVVENVIRVQ NDASETSTVK DEGGRVESGM VVYGDPNWTS  1200
ATPTSLVDPC CTLKAHEEDL GPGRVVVKAE PFVSLDTGAP SYTGVPLVTT QQSASVPVTS  1260
PLVTQSGPIR ERGARLNAAG EFKPRREPTS WTQEEKEKFA EIIRRHGKDW TLLDESLPGK  1320
SMTQIKTYFQ NSKAKLGFLS TDGLANPGTR GTCNRKRKPE ESDTSSNAGS AGQICPPKVT  1380
LPGEDVLQKV VSSSMMAIST SVGTAGVGGD GVAYSHFNPG NCQPGEDSAA RDLQKMIRRI  1440
CSASEYGAQS NIVGGILPIF QPGISSAYPG PNSQQSLLLA AQKQQLMVGH PTAQQVLPTQ  1500
VGLQQQQQPA LTNHKQQQLI SHVVQQLQQQ AVQQLQQQQQ QTNQLVVHQP QMVHQLQQLV  1560
QMQQQQQQHL AQVAKHIPPQ LVHQQSHQHL PLGPNVVHQQ QMVSRAKLAA AGVQQQVGHV  1620
SRLHPSHTQQ QLFQQQQQII QQQKQQQLIL QQIQATQLQH DLQLHQQMQV QKQQQQLPQH  1680
HHQQQQLQHG QPLALFRGSY QSSLAEAELL RHSEVVEQRN TPANLGLLPR EDLQVQSQRA  1740
QQNLAQQQQA RAPPSSESQR LRMGDVKLFG QSLLSQPQPN TGTPSISNTH KTGQPASPAT  1800
TAPSASSASK YFVVTEPTVL APPAFNRQAG TALVGEGSQS WPLGSVGNLD LWNSMMGGLQ  1860
GGGSLYKNED ASKLEVCSVH EAITKMTARP NREGHELEGD DLHNAPAGGI SNDHQRSTDA  1920
ACDLVRIGAS DASEGPNNDG HIRMENEWRI IPRANPAAVL NAQGGYSHVV LDPHYPYSGE  1980
RQSITSQGVV NQTWDGVRER DSNRNSVESG IGTLVPPALA SEMISQQINS RSEVYAPLSL  2040
PLPAAAAVTK ISSWPVSGSL ALAGESVGGS FQSQGVILRG LPDVEQPCTM ITDSKSKNVD  2100
NSGGPG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-16722814394NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-16722814394NUCLEAR RECEPTOR COREPRESSOR 2
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141145KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.19e-39MYB family protein